Bioregulator Quiz
0
Glass vial of Biolongevity Labs Tesamorelin/Ipamorelin, 6/2MG, with purity exceeding 99%, made in the USA
Tesamorelin and Ipamorelin (Blend) (8mg) - Image 2

Tesamorelin and Ipamorelin (Blend) (8mg)

This Tesamorelin/Ipamorelin blend combines Tesamorelin, a growth hormone-releasing hormone (GHRH) analogue, with Ipamorelin, a selective growth hormone secretagogue, to facilitate controlled studies of growth hormone pathways. The complementary mechanisms of these peptides may work together to potentially enhance body composition, support tissue repair, and improve metabolic parameters.

$115.00

Availability: In stock

Don't forget your BAC Water

Glass vial of Biolongevity Labs Reconstitution Solution, 30ml, containing deionized pure water and .9% benzyl alcohol, made in the USA.
Reconstitution Solution (30ml) (BAC Water)
$19.97
- +
Buy in bulk and save (not applicable with other sales)
  • Order 3 and save 4%
  • Order 6 and save 7%
  • Order 9 and save 10%
SKU TESA-IPA-8MG Category Tags , , , ,
Menu-bio
Description
Research
Certificate of Analysis
Description
Research
COA

Tesamorelin and Ipamorelin Blend Product Description

The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.

This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).

Tesamorelin and Ipamorelin Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

  • Tesamorelin acetate
  • 901758-09-6
  • TH9507
  • UNII-LGW5H38VE3
  • Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C38H49N9O5

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

  • 170851-70-4
  • Ipamorelin [INN]
  • NNC-26-0161
  • UNII-Y9M3S784Z6

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Weight 0.250 oz
Dimensions 0.625 × 0.625 × 1.5 in

99%+ Purity, Third Party Tested

Independently verified by three separate certified laboratories. COAs available pre-purchase.

GMP Manufacturing Standards

Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.

Best In Class Fulfillment

Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.

Zero Fillers or Additives

Pure active compounds only. Independently verified composition for reliable in vitro studies.

Scientific Reviewer

Scientifically reviewed by Dr. Ky H. Le, MD. Dr. Le is a board-certified family medicine physician with over 20 years of clinical experience. Dr. Le validates the scientific accuracy of all technical content and research citations.

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.
Glass vial of Biolongevity Labs Tesamorelin/Ipamorelin, 6/2MG, with purity exceeding 99%, made in the USATesamorelin and Ipamorelin (Blend) (8mg)
$115.00

Availability: In stock

Don't forget your BAC Water

Glass vial of Biolongevity Labs Reconstitution Solution, 30ml, containing deionized pure water and .9% benzyl alcohol, made in the USA.
Reconstitution Solution (30ml) (BAC Water)
$19.97
- +